General Information

  • ID:  hor002760
  • Uniprot ID:  A0A8J5MY90
  • Protein name:  NA
  • Gene name:  IGHMBP2-L
  • Organism:  Homarus americanus (American lobster)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0000166 nucleotide binding; GO:0003676 nucleic acid binding; GO:0003677 DNA binding; GO:0004386 helicase activity; GO:0005524 ATP binding; GO:0008270 zinc ion binding; GO:0016787 hydrolase activity; GO:0046872 metal ion binding
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  KPKTEKK
  • Length:  7(166-172)
  • Propeptide:  SESALVLIDTAGCECWELDTSDDQSKGNRSEAIIASHQVKTLISAGVPENDIAVITPYNLQVELVRSLLRTDHPGVEVRSVDGFQGREKEAVIMSLVRSNKQGMVGFLSEDRRLNVAVTRARRHLTVVCDTDTVSKHAFLKSFTDYVSQHELETTEVETPECIVWKPKTEKKERPKQPYSKNKRQDKPNDKKKYEPPSEEENIRRKKEYEAILGNFLKSSVQIYAFPPSLNSFERRLIHEICDELGLKHESKGEG
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002760_AF2.pdbhor002760_ESM.pdb

Physical Information

Mass: 96524 Formula: C38H71N11O11
Absent amino acids: ACDFGHILMNQRSVWY Common amino acids: K
pI: 10.8 Basic residues: 4
Polar residues: 1 Hydrophobic residues: 0
Hydrophobicity: -305.71 Boman Index: -3158
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 0
Instability Index: 2531.43 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18304551
  • Title:  Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus